Product Description
Size: 20ul / 150ul
The Carbonic Anhydrase 6/CA6 (26490-1-AP) by Proteintech is a Polyclonal antibody targeting Carbonic Anhydrase 6/CA6 in WB, ELISA applications with reactivity to human samples
26490-1-AP targets Carbonic Anhydrase 6/CA6 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: human saliva
Recommended dilution
Western Blot (WB): WB : 1:2000-1:16000
Background Information
CA6 (Carbonic anhydrase VI) is a member of CA family proteins that play a central role in pH regulation and electrolyte balance (PMID: 15633208). CA6 is also known as gustin, is a zinc-containing secreted protein which catalyzes the hydration of carbon hydroxide in saliva (PMID: 19721466). CA6 is specifically expressed in the salivary gland of a number of mammalian species (PMID:28423504). The amino acid sequences are highly conserved across the species. And it was reported that decreasing of CA6 protein was associated with loss of taste and pathological morphology of taste buds (PMID: 9784398).
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag24207 Product name: Recombinant human CA6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-86 aa of BC034350 Sequence: QHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHT Predict reactive species
Full Name: carbonic anhydrase VI
Calculated Molecular Weight: 35 kDa
Observed Molecular Weight: 35-40 kDa
GenBank Accession Number: BC034350
Gene Symbol: CA6
Gene ID (NCBI): 765
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P23280
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924