Proteintech, 26497-1-AP, HOXA10 Polyclonal antibody

Size: 20ul / 150ul The HOXA10 (26497-1-AP) by Proteintech is a Polyclonal antibody targeting HOXA10 in WB, ELISA applications with reactivity to human samples 26497-1-AP targets HOXA10 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information HOXA10, also named as Homeobox protein Hox-A10, is a 410 amino acid protein, which contains 1 homeobox DNA-binding domain and belongs to the Abd-B homeobox family. HOXA10 localizes in the nucleus and can Interacts with SIRT2. HOXA10 as sequence-specific transcription factor, is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. HoxA10 expression increases during the midsecretory phase of the menstrual cycle, which corresponds with increased levels of circulating progesterone. Specification Tested Reactivity: human Cited Reactivity: human, mouse, monkey, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24156 Product name: Recombinant human HOXA10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 203-311 aa of BC013971 Sequence: YGTAKGYGSGGGGAQQLGAGPFPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLACGSGGGSQGDEEAHASSSAAEELSPAPSESSKASPEKDSLGNSKGENAA Predict reactive species Full Name: homeobox A10 Calculated Molecular Weight: 393 aa, 41 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC013971 Gene Symbol: HOXA10 Gene ID (NCBI): 3206 RRID: AB_2880533 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P31260 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.