Iright
BRAND / VENDOR: Proteintech

Proteintech, 26500-1-AP, CCDC134 Polyclonal antibody

CATALOG NUMBER: 26500-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CCDC134 (26500-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC134 in WB, ELISA applications with reactivity to human, hamster samples 26500-1-AP targets CCDC134 in WB, ELISA applications and shows reactivity with human, hamster samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells, CHO cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Background Information CCDC134 (coiled-coil domain containing 134) encodes a secretory protein that can inhibit the MAPK pathway as a novel human MAPK-regulating protein (PMID: 18087676). CCDC134 is in extracellular secreted form, promotes proliferation and activation of CD8(+) T cells, suggesting a cytokine-like function (PubMed: 25125657). CCDC134 is widely expressed in normal adult tissues, tumor tissues and cell lines with the molecular weight of 27 kDa. Specification Tested Reactivity: human, hamster Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21990 Product name: Recombinant human CCDC134 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-229 aa of BC017693 Sequence: TLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVMLKGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRFPRIVHYYFDHNSNWNLLIRWGISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKEEKRKEIRKGPRISRSQSEL Predict reactive species Full Name: coiled-coil domain containing 134 Calculated Molecular Weight: 229 aa, 27 kDa Observed Molecular Weight: 27 kda GenBank Accession Number: BC017693 Gene Symbol: CCDC134 Gene ID (NCBI): 79879 RRID: AB_3669541 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H6E4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924