Proteintech, 26501-1-AP, AMBN Polyclonal antibody

Size: 20ul / 150ul The AMBN (26501-1-AP) by Proteintech is a Polyclonal antibody targeting AMBN in WB, IF/ICC, ELISA applications with reactivity to human samples 26501-1-AP targets AMBN in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information AMBN(Ameloblastin), the gene encodes the nonamelogenin enamel matrix protein ameloblastin. The encoded protein may be important in enamel matrix formation and mineralization. Mutations in this gene may be associated with dentinogenesis imperfect and autosomal dominant amylogenesis imperfect. It is expected to be located in the Vesicles, in addition localized to the Nucleoplasm, which is enriched in brain, and located at the Tomes processes of secretory ameloblasts and in the sheath space between rod-interrod enamel. The molecular weight of AMBN is 48 kDa. It also has phosphorylation modification. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24129 Product name: Recombinant human AMBN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 286-335 aa of BC106931 Sequence: RPGFEGMPHNPAMGGDFTLEFDSPVAATKGPENEEGGAQGSPMPEANPDN Predict reactive species Full Name: ameloblastin (enamel matrix protein) Calculated Molecular Weight: 447 aa, 48 kDa Observed Molecular Weight: 48-55 kDa GenBank Accession Number: BC106931 Gene Symbol: AMBN Gene ID (NCBI): 258 RRID: AB_3669542 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NP70 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.