Product Description
Size: 20ul / 150ul
The FCRL5 (26503-1-AP) by Proteintech is a Polyclonal antibody targeting FCRL5 in WB, ELISA applications with reactivity to human samples
26503-1-AP targets FCRL5 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: Daudi cells, Raji cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Background Information
FCRL5, also known as CD307 or IRTA2, is a surface protein expressed selectively on B cells and plasma cells (PMID: 11290337). This protein has both an immunoreceptor tyrosine-based activation motif (ITAM)-like sequence and two consensus immunoreceptor tyrosine-based inhibitory motifs (ITIM) in its cytoplasmic region (PMID: 17522256). FCRL5 is implicated in B cell development and lymphomagenesis (PMID: 11290337; 11453668). It may have an immunoregulatory role in marginal zone B-cells.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag24351 Product name: Recombinant human FCRL5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 245-375 aa of BC101067 Sequence: FQITAMWSKDSGFYWCKAATMPYSVISDSPRSWIQVQIPASHPVLTLSPEKALNFEGTKVTLHCETQEDSLRTLYRFYHEGVPLRHKSVRCERGASISFSLTTENSGNYYCTADNGLGAKPSKAVSLSVTV Predict reactive species
Full Name: Fc receptor-like 5
Calculated Molecular Weight: 977 aa, 106 kDa
Observed Molecular Weight: 100 kDa
GenBank Accession Number: BC101067
Gene Symbol: FCRL5
Gene ID (NCBI): 83416
RRID: AB_2880535
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q96RD9
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924