Iright
BRAND / VENDOR: Proteintech

Proteintech, 26510-1-AP, C13orf1 Polyclonal antibody

CATALOG NUMBER: 26510-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The C13orf1 (26510-1-AP) by Proteintech is a Polyclonal antibody targeting C13orf1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 26510-1-AP targets C13orf1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-12 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information C13orf1, also named as SPRYD7 and CLLD6, is involved in hematopoiesis via NOTCH signaling. C13orf1 plays an important role in the pathogenesis of B-CLL. There're some isoforms of C13orf1 with MW 15-17 kDa and 19-22 kDa.3 Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23487 Product name: Recombinant human C13orf1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-157 aa of BC022519 Sequence: MATSVLCCLRCCRDGGTGHIPLKEMPAVQLDTQHMGIWGIGVATQKVNLNQIPLGRDMHSLVMRNDGALYHNNEEKNRLPANSLPQEGDVVGITYDHVELNVYLNGKNMHCPASGIRGTVYPVVYDDDSAILDCQFSEFYHTPPPGFEKILFEQQIF Predict reactive species Full Name: chromosome 13 open reading frame 1 Observed Molecular Weight: 17 kDa, 20 kDa GenBank Accession Number: BC022519 Gene Symbol: C13orf1 Gene ID (NCBI): 57213 RRID: AB_2880536 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5W111 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924