Iright
BRAND / VENDOR: Proteintech

Proteintech, 26517-1-AP, DEPDC7 Polyclonal antibody

CATALOG NUMBER: 26517-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The DEPDC7 (26517-1-AP) by Proteintech is a Polyclonal antibody targeting DEPDC7 in WB, ELISA applications with reactivity to human samples 26517-1-AP targets DEPDC7 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information DEPDC7 (DEP domain-containing protein 7), also known as protein TR2/D15, is a 511 amino acid protein belonging to the DEPDC7 family. DEPDC7 contains one DEP domain and is highly expressed in liver, with lower levels in kidney. DEPDC7 exists as two isoforms produced by alternative splicing events. The gene encoding DEPDC7 maps to human chromosome 11p13 and mouse chromosome 2 E2. With approximately 135 million base pairs and 1,400 genes, chromosome 11 makes up around 4% of human genomic DNA and is considered a gene and disease association dense chromosome. DEPDC7 involves the regulation of small GTPase mediated signal transduction. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24094 Product name: Recombinant human DEPDC7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 344-511 aa of BC030970 Sequence: QLLLKLLDFQNREEFRRLLYFMAVAANPSEFKLQKESDNRMVVKRIFSKAIVDNKNLSKGKTDLLVLFLMDHQKDVFKIPGTLHKIVSVKLMAIQNGRDPNRDAGYIYCQRIDQRDYSNNIEKTTKDELLNLLKTLDEDSKLSAKEKKKLLGQFYKCHPDIFIEHFGD Predict reactive species Full Name: DEP domain containing 7 Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC030970 Gene Symbol: DEPDC7 Gene ID (NCBI): 91614 RRID: AB_2880539 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96QD5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924