Proteintech, 26527-1-AP, CCL20/MIP-3 alpha Polyclonal antibody

Size: 20ul / 150ul The CCL20/MIP-3 alpha (26527-1-AP) by Proteintech is a Polyclonal antibody targeting CCL20/MIP-3 alpha in IHC, ELISA applications with reactivity to human samples 26527-1-AP targets CCL20/MIP-3 alpha in IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human lung cancer tissue, human pancreas cancer tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CCL20, also known as macrophage infiltrating factor protein 3α, is a C-C chemokine that specifically binds to the receptor CCR6. CCL20 is produced in various tissues and by a wide range of immune cells, including neutrophils, natural killer cells, T-helper type 17 (Th17) cells, B cells, and various antigen-presenting cells, such as dendritic cells (DCs), Langerhans cells, and macrophages. Increased expression of CCL20 is likely involved in the increased recruitment of dendritic cells observed in fibroinflammatory diseases such as chronic obstructive pulmonary disease (COPD). CCL20 expression is increased by the proinflammatory cytokine IL-1 beta. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24069 Product name: Recombinant human MIP-3α protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-95 aa of BC020698 Sequence: ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM Predict reactive species Full Name: chemokine (C-C motif) ligand 20 Calculated Molecular Weight: 11 kDa GenBank Accession Number: BC020698 Gene Symbol: CCL20/MIP-3 alpha Gene ID (NCBI): 6364 RRID: AB_2880543 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P78556 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.