Iright
BRAND / VENDOR: Proteintech

Proteintech, 26540-1-AP, SLC39A14/ZIP-14 Polyclonal antibody

CATALOG NUMBER: 26540-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SLC39A14/ZIP-14 (26540-1-AP) by Proteintech is a Polyclonal antibody targeting SLC39A14/ZIP-14 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 26540-1-AP targets SLC39A14/ZIP-14 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, mouse spleen tissue, rat heart tissue Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Metal cation symporter ZIP14 (SLC39A14) is an electroneutral transporter of the plasma membrane that mediates the cellular uptake of divalent metal cations zinc, manganese, and iron and is important for tissue homeostasis, metabolism, development and immunity (PubMed:15642354, PubMed:27231142, PubMed:29621230). The molecular weight is around 53-54 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24210 Product name: Recombinant human SLC39A14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 34-152 aa of BC015770 Sequence: GAPAISAASFLQDLIHRYGEGDSLTLQQLKALLNHLDVGVGRGNVTQHVQGHRNLSTCFSSGDLFTAHNFSEQSRIGSSELQEFCPTILQQLDSRACTSENQENEENEQTEEGRPSAVE Predict reactive species Full Name: solute carrier family 39 (zinc transporter), member 14 Calculated Molecular Weight: 54 kDa Observed Molecular Weight: 54 kDa GenBank Accession Number: BC015770 Gene Symbol: SLC39A14/ZIP-14 Gene ID (NCBI): 23516 RRID: AB_3085879 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15043 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924