Iright
BRAND / VENDOR: Proteintech

Proteintech, 26551-1-AP, Phospholipase C Beta 1 Polyclonal antibody

CATALOG NUMBER: 26551-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Phospholipase C Beta 1 (26551-1-AP) by Proteintech is a Polyclonal antibody targeting Phospholipase C Beta 1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 26551-1-AP targets Phospholipase C Beta 1 in WB, IHC, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, rat brain tissue, U-251 cells, mouse brain tissue, rat tissue Positive IHC detected in: human gliomas tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PLCB1 catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of many extracellular signals. PLCB1 is activated by two G-protein alpha subunits, alpha-q and alpha-11. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24750 Product name: Recombinant human PLCB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1162-1216 aa of BC069420 Sequence: LEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSSEELGGDIPGKEFDTPL Predict reactive species Full Name: phospholipase C, beta 1 (phosphoinositide-specific) Calculated Molecular Weight: 1216 aa, 139 kDa Observed Molecular Weight: 139 kDa GenBank Accession Number: BC069420 Gene Symbol: PLCB1 Gene ID (NCBI): 23236 RRID: AB_2861360 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NQ66 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924