Proteintech, 26557-1-AP, ECT2 Polyclonal antibody

Size: 20ul / 150ul The ECT2 (26557-1-AP) by Proteintech is a Polyclonal antibody targeting ECT2 in WB, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples 26557-1-AP targets ECT2 in WB, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HEK-293T cells, Calu-1 cells, K-562 cells Positive IP detected in: K-562 cells Positive IF/ICC detected in: A549 cells Positive FC (Intra) detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Epithelial cell transforming sequence 2 (Ect2) is a guanine nucleotide exchange factor (GEF) for the Rho family GTPases, Rac1, RhoA and Cdc42. Ect2 catalyzes the exchange of GDP for GTP, thereby activating the Rho GTPases toward their downstream effectors  (PMID: 35069543). The cellular localization of Ect2 is cell cycle dependent. Ect2 is localized predominantly in the nucleus during interphase due to two functional NLS sequences found within its central hinge region.1 At the onset of mitosis, Ect2 is dispersed throughout the cytoplasm where it associates with the mitotic spindle at metaphase, the cleavage furrow during telophase, and the mid-body during cytokinesis (PMID: 35069543). Besides normal cellular activity, ECT2 also participates in malignant transformation, tumor initiation, and metastasis (PMID: 36572949). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24836 Product name: Recombinant human ECT2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC112086 Sequence: MAENSVLTSTTGRTSLADSSIFDSKVTEISKENLLIGSTSYVEEEMPQIETRVILVQEAGKQEELIKALKDIKVGFVKMESVEEFEGLDSPEFENVFVVTDFQDSVFNDLYKADCRVIGPPVVLNCSQKGEPLPFSCRPLYCTSMMNLVLCFTGFRKKEELVRLVTLVHHMGGVIRKDFNSKVTHLVANCTQGEKFRVAVSLGTPIMKPEWIYKAWERRNEQDFYAAVDDFRNEFKVPPFQDCILSFLGFSDEEKTNMEEMTEMQGGKYLPLGDERCTHLVVEENIVKDLPFEPSKKLYVVKQEWFWGSIQMDARAGETMYLYEKANTPELKKSVSMLSLNTPNSNRKRR Predict reactive species Full Name: epithelial cell transforming sequence 2 oncogene Observed Molecular Weight: 100 kDa GenBank Accession Number: BC112086 Gene Symbol: ECT2 Gene ID (NCBI): 1894 RRID: AB_3669547 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H8V3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.