Proteintech, 26559-1-AP, CMTM4 Polyclonal antibody

Size: 20ul / 150ul The CMTM4 (26559-1-AP) by Proteintech is a Polyclonal antibody targeting CMTM4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 26559-1-AP targets CMTM4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information CMTM4 belongs to the CKLF-like MARVEL transmembrane domain containing (CMTM) family which contain a structurally conserved MAL and related proteins for vesicle trafficking and membrane linking (MARVEL) domain (PMID: 32944388). CMTM4 plays an important role in mediating endothelial barrier function and controlling vascular sprouting (PMID: 30097810). CMTM4 has been reported to be the major regulator of PD-L1 in liver cancer (PMID: 34558800) and play a tumor suppressive role in colorectal cancer (PMID: 31435638). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23648 Product name: Recombinant human CMTM4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-82 aa of BC093679 Sequence: MRSGEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYLRGALGRLKVAQVILALIAFICIETIMACSPCE Predict reactive species Full Name: CKLF-like MARVEL transmembrane domain containing 4 Observed Molecular Weight: 26 kDa GenBank Accession Number: BC093679 Gene Symbol: CMTM4 Gene ID (NCBI): 146223 RRID: AB_3085882 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IZR5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.