Proteintech, 26562-1-AP, ATG101 Polyclonal antibody

Size: 20ul / 150ul The ATG101 (26562-1-AP) by Proteintech is a Polyclonal antibody targeting ATG101 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 26562-1-AP targets ATG101 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IP detected in: HeLa cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:800 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22932 Product name: Recombinant human C12orf44 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-218 aa of BC005151 Sequence: MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGTQDVDCDFIDFTYVRVSSEELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWEVWTVKVHVVALATEQERQICREKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDTGLRDVQPYLYKISFQITDALGTSVTTTMRRLIKDTLAL Predict reactive species Full Name: chromosome 12 open reading frame 44 Calculated Molecular Weight: 218 aa, 25 kDa Observed Molecular Weight: 25-28 kDa GenBank Accession Number: BC005151 Gene Symbol: ATG101 Gene ID (NCBI): 60673 RRID: AB_2880554 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BSB4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.