Proteintech, 26564-1-AP, ABCA1 Polyclonal antibody

Size: 20ul / 150ul The ABCA1 (26564-1-AP) by Proteintech is a Polyclonal antibody targeting ABCA1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 26564-1-AP targets ABCA1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse cerebellum tissue Positive IHC detected in: rat lung tissue, mouse lung tissue, rat liver tissue, rat stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABCA, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABCA subfamily. Members of the ABCA subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. With cholesterol as its substrate, this protein functions as a cholesterol efflux pump in the cellular lipid removal pathway. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24118 Product name: Recombinant human ABCA1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 92-272 aa of BC141816 Sequence: GVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQGYQLHLTSLCNGSKSEEMIQLGDQEVSELCGLPKEKLAAAERVLRSNMDILKPILRTLNSTSPFPSKELAEATKTLLHSLGTLAQEM Predict reactive species Full Name: ATP-binding cassette, sub-family A (ABC1), member 1 Calculated Molecular Weight: 2261 aa, 254 kDa Observed Molecular Weight: 250 kDa GenBank Accession Number: BC141816 Gene Symbol: ABCA1 Gene ID (NCBI): 19 RRID: AB_3085884 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95477 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.