Iright
BRAND / VENDOR: Proteintech

Proteintech, 26571-1-AP, FAM84A Polyclonal antibody

CATALOG NUMBER: 26571-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FAM84A (26571-1-AP) by Proteintech is a Polyclonal antibody targeting FAM84A in WB, ELISA applications with reactivity to human samples 26571-1-AP targets FAM84A in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HT-29 cells, HL-60 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information FAM84A (Family with sequence similarity 84, member A) plays a role in cell morphology and motility. It is also related to the occurrence and development of cancer by affecting cell migration (PMID: 33751775; 16820875). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23773 Product name: Recombinant human FAM84A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-132 aa of BC052284 Sequence: MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSRHHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALCEPGDLLELLWLQ Predict reactive species Full Name: family with sequence similarity 84, member A Observed Molecular Weight: 32-37 kDa GenBank Accession Number: BC052284 Gene Symbol: FAM84A Gene ID (NCBI): 151354 RRID: AB_3669549 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96KN4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924