Proteintech, 26574-1-AP, OAT1 Polyclonal antibody

Size: 20ul / 150ul The OAT1 (26574-1-AP) by Proteintech is a Polyclonal antibody targeting OAT1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 26574-1-AP targets OAT1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information OAT1, also named as SLC22A6, has two GXXXG motifs in its transmembrane which is associated with protein processing and oligomerization of other proteins. OAT1 is involved in the renal elimination of endogenous and exogenous organic anions. It has been reported that OAT1 plays a key role in clearing endogenous metabolites, toxins and drugs from blood. OAT1 has some isoforms and the calculated MW ranges from 55 kDa to 62 kDa. 26574-1-AP antibody detects the 60-65 kDa (native forms) and 70-80 kDa (mature forms) protein in SDS-PAGE. (PMID: 21340049, 23389457, 23196129) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24234 Product name: Recombinant human SLC22A6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 476-550 aa of BC033682 Sequence: SMTAELYPSMPLFIYGAVPVAASAVTVLLPETLGQPLPDTVQDLESRKGKQTRQQQEHQKYMVPLQASAQEKNGL Predict reactive species Full Name: solute carrier family 22 (organic anion transporter), member 6 Calculated Molecular Weight: 62 kDa Observed Molecular Weight: 60-65 and 70-80 kDa GenBank Accession Number: BC033682 Gene Symbol: OAT1 Gene ID (NCBI): 9356 RRID: AB_2880557 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q4U2R8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.