Proteintech, 26575-1-AP, C22orf29 Polyclonal antibody

Size: 20ul / 150ul The C22orf29 (26575-1-AP) by Proteintech is a Polyclonal antibody targeting C22orf29 in WB, ELISA applications with reactivity to human samples 26575-1-AP targets C22orf29 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24111 Product name: Recombinant human C22orf29 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-364 aa of BC011679 Sequence: MPRGRCRQQGPRIPIWAAANYANAHPWQQMDKASPGVAYTPLVDPWIERPCCGDTVCVRTTMEQKSTASGTCGGKPAERGPLAGHMPSSRPHRVDFCWVPGSDPGTFDGSPWLLDRFLAQLGDYMSFHFEHYQDNISRVCEILRRLTGRAQAWAAPYLDGDLPLPDDYELFCQDLKEVVQDPNSFAEYHAVVTCPLPLASSQLPVAPQLPVVRQYLARFLEGLALDMGTAPRSLPAAMATPAVSGSNSVSRSALFEQQLTKESTPGPKEPPVLPSSTCSSKPGPVEPASSQPEEAAPTPVPRLSESANPPAQRPDPAHPGGPKPQKTEEEVLETEGDQEVSLGTPQEVVEAPETPGEPPLSPGF Predict reactive species Full Name: chromosome 22 open reading frame 29 Observed Molecular Weight: 39-45 kDa GenBank Accession Number: BC011679 Gene Symbol: C22orf29 Gene ID (NCBI): 79680 RRID: AB_3085886 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7L3V2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.