Iright
BRAND / VENDOR: Proteintech

Proteintech, 26582-1-AP, SCF Polyclonal antibody

CATALOG NUMBER: 26582-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SCF (26582-1-AP) by Proteintech is a Polyclonal antibody targeting SCF in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 26582-1-AP targets SCF in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-12 cells, NIH/3T3 cells, mouse colon tissue Positive IHC detected in: human kidney tissue, human small intestine tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Stem cell factor (SCF) also known as mast cell growth factor, steel factor, and kit ligand, is a hematopoietic growth factor. SCF is a critical protein with key roles in the cell such as hematopoiesis, gametogenesis and melanogenesis. SCF activates multiple signal pathways by binding with c-kit receptor. SCF and its receptor, c-kit ligand (KL), are up-regulated in particular human malignancies including gastrointestinal stromal tumor (GISTs), breast cancer, hematopoietic cell, myeloid leukaemia, and glioma. The SCF/c-KIT system also plays a relevant role in cell fate decision, and its activity is widely known to control cell proliferation, differentiation, survival and apoptosis. SCF is a 35 to 45 kDa monomeric glycoprotein. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25075 Product name: Recombinant human SCF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 28-214 aa of BC074725 Sequence: ICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLH Predict reactive species Full Name: KIT ligand Calculated Molecular Weight: 273 aa, 31 kDa Observed Molecular Weight: 30-45 kDa GenBank Accession Number: BC074725 Gene Symbol: SCF Gene ID (NCBI): 4254 RRID: AB_2880561 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P21583 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924