Iright
BRAND / VENDOR: Proteintech

Proteintech, 26584-1-AP, SP3 Polyclonal antibody

CATALOG NUMBER: 26584-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SP3 (26584-1-AP) by Proteintech is a Polyclonal antibody targeting SP3 in WB, IHC, ELISA applications with reactivity to human, mouse samples 26584-1-AP targets SP3 in WB, IHC, ChIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: PC-3 cells, C2C12 cell, COLO 320 cells Positive IHC detected in: mouse lung tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information SP3, also named as transcription factor Sp3, is a 781 amino acid protein, which contains 3 C2H2-type zinc fingers and belongs to the Sp1 C2H2-type zinc-finger protein family. SP3 localizes to the nuclear periphery and in nuclear dots when sumoylated. Some localization in PML nuclear bodies. SP3 is acetylated by histone acetyltransferase p300, deacetylated by HDACs and sumoylated on all isoforms. Sumoylated on 2 sites in longer isoforms with Lys-551 being the major site. Sumoylation at this site promotes nuclear localization to the nuclear periphery, nuclear dots and PML nuclear bodies. Sumoylation on Lys-551 represses the transactivation activity, except for the largest isoform, L-Sp3, which has little effect on transactivation. Alternate sumoylation and acetylation at Lys-551 also control transcriptional activity. There exist tow modified isoform and molecular weight of those are 70 kda and 115 kda. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25082 Product name: Recombinant human SP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 412-590 aa of BC126414 Sequence: IVQGITPQTIHGVQASGQNISQQALQNLQLQLNPGTFLIQAQTVTPSGQVTWQTFQVQGVQNLQNLQIQNTAAQQITLTPVQTLTLGQVAAGGAFTSTPVSLSTGQLPNLQTVTVNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQHQ Predict reactive species Full Name: Sp3 transcription factor Calculated Molecular Weight: 781 aa, 82 kDa Observed Molecular Weight: 70 kDa, 115 kDa GenBank Accession Number: BC126414 Gene Symbol: SP3 Gene ID (NCBI): 6670 RRID: AB_2880563 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q02447 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924