Proteintech, 26585-1-AP, MMP1 Polyclonal antibody

Size: 20ul / 150ul The MMP1 (26585-1-AP) by Proteintech is a Polyclonal antibody targeting MMP1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 26585-1-AP targets MMP1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A375 cells, NIH/3T3 cells Positive IP detected in: Raji cells Positive IHC detected in: human cervical cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:100-1:400 Background Information MMP1, also named as CLG, belongs to the peptidase M10A family. MMP is the main enzyme that cleaves fibrillar collagen, namely types I, II, III, VII, and X.It is involved in cell migration and invasion, and is frequently up-regulated in cancer cells. It can be cleavage to two major forms (22 kDa and 27 kDa) by undergoing autolytic,and the minor form (25 kDa) is the glycosylated form of the 22 kDa form. The 27 kDa form has no activity while the 22/25 kDa form can act as activator for collagenase.The sizes of pro-MMP-1 and active MMP-1 from human synovial fibroblasts have been reported as 52 to 56 kDa, depending on glycosylation, and 41 to 45 kDa, respectively.In addition ,a band of 62-kDa observed in the current study is pro-MMp-1(PMID:9418730). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25073 Product name: Recombinant human MMP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 428-469 aa of BC013875 Sequence: AVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN Predict reactive species Full Name: matrix metallopeptidase 1 (interstitial collagenase) Calculated Molecular Weight: 54 kDa Observed Molecular Weight: 62 kDa GenBank Accession Number: BC013875 Gene Symbol: MMP1 Gene ID (NCBI): 4312 RRID: AB_2880564 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P03956 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.