Iright
BRAND / VENDOR: Proteintech

Proteintech, 26587-1-AP, p70(S6K) Polyclonal antibody

CATALOG NUMBER: 26587-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The p70(S6K) (26587-1-AP) by Proteintech is a Polyclonal antibody targeting p70(S6K) in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 26587-1-AP targets p70(S6K) in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, A549 cells Positive IP detected in: A549 cells Positive IHC detected in: human lung cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information RPS6KB1(Ribosomal protein S6 kinase beta-1) is also named as STK14A, p70 S6KA and belongs to the S6 kinase subfamily. RPS6KB1 is a major substrate of MTOR and acts as a crucial effector of MTOR signaling pathway. It plays a key role in cell growth and proliferation by regulating INS sensitivity, metabolism, protein synthesis, and cell cycle. RPS6KB1 may play an important role in the progression of HCC and could serve as a potential molecular target for HCC therapy (PMID:22684641). RPS6KB1 is a 70 kDa protein and has 5 isoforms with the calculated molecular mass of 51-59kDa produced by alternative initiation. Specification Tested Reactivity: human Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24073 Product name: Recombinant human p70(S6K) protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-74 aa of BC053365 Sequence: MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPYELGMEHCEKFEI Predict reactive species Full Name: ribosomal protein S6 kinase, 70kDa, polypeptide 1 Calculated Molecular Weight: 59 kDa Observed Molecular Weight: 60-75 kDa GenBank Accession Number: BC053365 Gene Symbol: p70 S6K Gene ID (NCBI): 6198 RRID: AB_2880565 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P23443 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924