Product Description
Size: 20ul / 150ul
The XCL1 (26605-1-AP) by Proteintech is a Polyclonal antibody targeting XCL1 in WB, IHC, ELISA applications with reactivity to human samples
26605-1-AP targets XCL1 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: PMA, Ionomycin and Brefeldin A treated NK-92 cells
Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:1000-1:5000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
XCL1 also known as Lymphotactin, is a member of the chemokine superfamily. Chemokines function in inflammatory and immunological responses, inducing leukocyte migration and activation.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag24258 Product name: Recombinant human XCL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-114 aa of BC070309 Sequence: SEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG Predict reactive species
Full Name: chemokine (C motif) ligand 1
Calculated Molecular Weight: 114 aa, 13 kDa
Observed Molecular Weight: 13 kDa
GenBank Accession Number: BC070309
Gene Symbol: XCL1
Gene ID (NCBI): 6375
RRID: AB_3669553
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P47992
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924