Iright
BRAND / VENDOR: Proteintech

Proteintech, 26605-1-AP, XCL1 Polyclonal antibody

CATALOG NUMBER: 26605-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The XCL1 (26605-1-AP) by Proteintech is a Polyclonal antibody targeting XCL1 in WB, IHC, ELISA applications with reactivity to human samples 26605-1-AP targets XCL1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PMA, Ionomycin and Brefeldin A treated NK-92 cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information XCL1 also known as Lymphotactin, is a member of the chemokine superfamily. Chemokines function in inflammatory and immunological responses, inducing leukocyte migration and activation. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24258 Product name: Recombinant human XCL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-114 aa of BC070309 Sequence: SEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG Predict reactive species Full Name: chemokine (C motif) ligand 1 Calculated Molecular Weight: 114 aa, 13 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC070309 Gene Symbol: XCL1 Gene ID (NCBI): 6375 RRID: AB_3669553 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P47992 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924