Product Description
Size: 20ul / 150ul
The DRP2 (26631-1-AP) by Proteintech is a Polyclonal antibody targeting DRP2 in WB, ELISA applications with reactivity to human, mouse, rat samples
26631-1-AP targets DRP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse brain tissue, rat brain tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag24462 Product name: Recombinant human DRP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 865-954 aa of BC111695 Sequence: QRLRELLLQPPTESDGSGSAGSSLASSPQQSEGSHPREKGQTTPDTEAADDVGSKSQDVSLCLEDIMEKLRHAFPSVRSSDVTANTLLAS Predict reactive species
Full Name: dystrophin related protein 2
Calculated Molecular Weight: 957 aa, 108 kDa
Observed Molecular Weight: 100-110 kDa
GenBank Accession Number: BC111695
Gene Symbol: DRP2
Gene ID (NCBI): 1821
RRID: AB_2880580
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q13474
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924