Proteintech, 26632-1-AP, DUOXA1 Polyclonal antibody

Size: 20ul / 150ul The DUOXA1 (26632-1-AP) by Proteintech is a Polyclonal antibody targeting DUOXA1 in WB, ELISA applications with reactivity to human, mouse samples 26632-1-AP targets DUOXA1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse colon tissue, Jurkat cells, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information DUOXA1, also named as NIP and NUMBIP, originally identified as a Numb-interacting protein, was recently shown to function as a maturation factor for the dual oxidase 1(DUOX1). DUOXA1 transient overexpression affected the cell-cell adhesion by modulating the actin cytoskeleton, and sensitized cells to doxorubicin. DUOXA1 has some isoforms with MW 33 kDa, 38 kDa and 54 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24373 Product name: Recombinant human DUOXA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 162-298 aa of BC020841 Sequence: GYMLLATGIFQLLALLFFSMATSLTSPCPLHLGASVLHTHHGPAFWITLTTGLLCVLLGLAMAVAHRMQPHRLKAFFNQSVDEDPMLEWSPEEGGLLSPRYRSMADSPKSQDIPLSEASSTKAYCKEAHPKDPDCAL Predict reactive species Full Name: dual oxidase maturation factor 1 Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 29 kDa, 52 kDa GenBank Accession Number: BC020841 Gene Symbol: DUOXA1 Gene ID (NCBI): 90527 RRID: AB_2880581 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q1HG43 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.