Proteintech, 26644-1-AP, LIN54 Polyclonal antibody

Size: 20ul / 150ul The LIN54 (26644-1-AP) by Proteintech is a Polyclonal antibody targeting LIN54 in WB, ELISA applications with reactivity to human samples 26644-1-AP targets LIN54 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information LIN54 is a component of the LINC/DREAM complex, an important regulator of cell cycle genes (PMID: 17671431; 19725879). The complex binds to more than 800 promoters in G0 phase and is required for repression of E2F target genes (PMID:17531812). In S phase, the complex binds to the promoters of G2/M genes whose products are required for mitosis and plays an important role in their cell cycle dependent activation (PMID:17671431). LIN54 has a DNA binding region (CXC-hinge-CXC, CHC domain), which consists of two cysteine-rich (CXC) domains separated by a short spacer. It has been reported that the CHC domain functions as a DNA binding domain, and conserved cysteine residues in two CXC domains are essential for DNA binding (PMID: 22895175). The calculated molecular weight of LIN54 is 79 kDa and an apparent molecular mass of 100-110 kDa has been reported (PMID: 17531812; 28920576; 17671431). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24507 Product name: Recombinant human LIN54 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 555-631 aa of BC109278 Sequence: LADAAEVRVQQQTAAKTKLSSQISDLLTRPTPALNSGGGKLPFTFVTKEVAEATCNCLLAQAEQADKKGKSKAAAER Predict reactive species Full Name: lin-54 homolog (C. elegans) Calculated Molecular Weight: 749 aa, 79 kDa Observed Molecular Weight: 79 kDa, 100 kDa GenBank Accession Number: BC109278 Gene Symbol: LIN54 Gene ID (NCBI): 132660 RRID: AB_3669558 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6MZP7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.