Iright
BRAND / VENDOR: Proteintech

Proteintech, 26656-1-AP, S100A7/Psoriasin Polyclonal antibody

CATALOG NUMBER: 26656-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The S100A7/Psoriasin (26656-1-AP) by Proteintech is a Polyclonal antibody targeting S100A7/Psoriasin in WB, IHC, ELISA applications with reactivity to human samples 26656-1-AP targets S100A7/Psoriasin in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, MDA-MB-468 cells Positive IHC detected in: human oesophagus cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information S100A7 (psoriasin), a member of the S100 protein family, is a well-known antimicrobial peptide and a signaling molecule which regulates cellular function and is expressed in many squamous cell carcinomas (SCCs), such as SCC of the skin. It is an EF-hand type calcium binding protein localized in epithelial cells, regulates cell proliferation and differentiation. The protein is overexpressed in hyperproliferative skin diseases, exhibits antimicrobial activities against bacteria and induces immunomodulatory activities. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24717 Product name: Recombinant human S100A7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-35 aa of BC034687 Sequence: MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTM Predict reactive species Full Name: S100 calcium binding protein A7 Calculated Molecular Weight: 101 aa, 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: BC034687 Gene Symbol: S100A7/Psoriasin Gene ID (NCBI): 6278 RRID: AB_2880592 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P31151 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924