Proteintech, 26659-1-AP, DENND4A Polyclonal antibody

Size: 20ul / 150ul The DENND4A (26659-1-AP) by Proteintech is a Polyclonal antibody targeting DENND4A in WB, ELISA applications with reactivity to human samples 26659-1-AP targets DENND4A in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information DENND4A (DENN domain-containing protein 4A), also called IRLB and MYCPBP, is a probable guanine nucleotide exchange factor (GEF) that may activate RAB10. It can promote the exchange of GDP to GTP, converting inactive GDP-bound Rab proteins into their active GTP-bound form. It may bind to the ISRE-like element (interferon-stimulated response element) of the MYC P2 promoter (PMID: 20937701; 8056341). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24568 Product name: Recombinant human DENND4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1478-1634 aa of BC041706 Sequence: TTCPFCGNIFLPFLNIEIRDLRRPGRYFLKSSPSTENMHFPSSISSQTRQSCISTSASGLDTSALSVQGNFDLNSKSKLQENFCTRSIQIPANRSKTAMSKCPIFPMARSISTSGPLDKEDTGRQKLISTGSLPATLQGATDSLGLEWHLPSPDPVT Predict reactive species Full Name: DENN/MADD domain containing 4A Observed Molecular Weight: 230 kDa GenBank Accession Number: BC041706 Gene Symbol: DENND4A Gene ID (NCBI): 10260 RRID: AB_3669559 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z401 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.