Proteintech, 26661-1-AP, EGFL7 Polyclonal antibody

Size: 20ul / 150ul The EGFL7 (26661-1-AP) by Proteintech is a Polyclonal antibody targeting EGFL7 in WB, IHC, ELISA applications with reactivity to human samples 26661-1-AP targets EGFL7 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells, K-562 cells, RKO cells Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Epidermal growth factor-like protein 7 (EGFL7, also known as MEGF7, ZNEU1, and VE-STATIN) is a proangiogenic factor that has been widely described as having a vital role in tubulogenesis and regulation of angiogenesis, mainly during embryogenesis organogenesis (PMID: 22160377; 15162510). It also can reduce central nervous system inflammation and may play a role in tumorigenesis (PMID: 29483510; 37490307). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24693 Product name: Recombinant human EGFL7 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 141-273 aa of BC012377 Sequence: CSARRGGCPQRCINTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS Predict reactive species Full Name: EGF-like-domain, multiple 7 Calculated Molecular Weight: 273 aa, 30 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC012377 Gene Symbol: EGFL7 Gene ID (NCBI): 51162 RRID: AB_3669560 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UHF1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.