Proteintech, 26662-1-AP, SYCN Polyclonal antibody

Size: 20ul / 150ul The SYCN (26662-1-AP) by Proteintech is a Polyclonal antibody targeting SYCN in WB, ELISA applications with reactivity to human, mouse samples 26662-1-AP targets SYCN in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse pancreas tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information SYCN (Syncollin) functions in exocytosis in pancreatic acinar cells regulating the fusion of zymogen granules with each other. It also may have a pore-forming activity on membranes and regulate exocytosis in other exocrine tissues. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24489 Product name: Recombinant human SYCN protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 25-134 aa of BC121075 Sequence: ASADLKHSDGTRTCAKLYDKSDPYYENCCGGAELSLESGADLPYLPSNWANTASSLVVAPRCELTVWSRQGKAGKTHKFSAGTYPRLEEYRRGILGDWSNAISALYCRCS Predict reactive species Full Name: syncollin Calculated Molecular Weight: 134 aa, 14 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC121075 Gene Symbol: SYCN Gene ID (NCBI): 342898 RRID: AB_3669561 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q0VAF6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.