Proteintech, 26685-1-AP, SSPN Polyclonal antibody

Size: 20ul / 150ul The SSPN (26685-1-AP) by Proteintech is a Polyclonal antibody targeting SSPN in WB, ELISA applications with reactivity to human, mouse, rat samples 26685-1-AP targets SSPN in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24511 Product name: Recombinant human SSPN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-73 aa of BC062299 Sequence: MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVVGFL Predict reactive species Full Name: sarcospan (Kras oncogene-associated gene) Calculated Molecular Weight: 243 aa, 27 kDa Observed Molecular Weight: 15-20 kDa, 27 kDa GenBank Accession Number: BC062299 Gene Symbol: SSPN Gene ID (NCBI): 8082 RRID: AB_2880602 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14714 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.