Iright
BRAND / VENDOR: Proteintech

Proteintech, 26687-1-AP, BTN1A1 Polyclonal antibody

CATALOG NUMBER: 26687-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The BTN1A1 (26687-1-AP) by Proteintech is a Polyclonal antibody targeting BTN1A1 in WB, ELISA applications with reactivity to human samples 26687-1-AP targets BTN1A1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Caco-2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information BTN1A1, also named as Butyrophilin subfamily 1 member A1, is a 526 amino acid protein, which contains 1 B30.2/SPRY domain and belongs to the immunoglobulin superfamily. BTN/MOG family. BTN1A1 localizes in the integral component of plasma membrane. BTN1A1 may function in the secretion of milk-fat droplets and may act as a specific membrane-associated receptor for the association of cytoplasmic droplets with the apical plasma membrane. BTN1A1 Inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion. The calculated molecular weight of BTN1A1 is a 59 kDa, but the modified BTN1A1 protein is about 65-75 kDa. Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24613 Product name: Recombinant human BTN1A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 448-526 aa of BC096312 Sequence: SNVTFSGPLRPFFCLWSSGKKPLTICPIADGPERVTVIANAQDLSKEIPLSPMGEDSAPRDADTLHSKLIPTQPSQGAP Predict reactive species Full Name: butyrophilin, subfamily 1, member A1 Calculated Molecular Weight: 526 aa, 59 kDa Observed Molecular Weight: 65-75 kDa GenBank Accession Number: BC096312 Gene Symbol: BTN1A1 Gene ID (NCBI): 696 RRID: AB_2880603 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13410 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924