Proteintech, 26689-1-AP, CYR61/CCN1 Polyclonal antibody

Size: 20ul / 150ul The CYR61/CCN1 (26689-1-AP) by Proteintech is a Polyclonal antibody targeting CYR61/CCN1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples 26689-1-AP targets CYR61/CCN1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, MDA-MB-453s cells, HeLa cells Positive IP detected in: HeLa cells Positive IHC detected in: human colon cancer tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells, MCF-7 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CYR61 is a member of the CYR61/CTGF/NOV (CCN) protein family. CYR61 participated in cell mitogenesis, cellular adhesion, migration, differentiation, angiogenesis, and survival. Cyr61 is especially associated with diseases related to chronic inflammation, including RA, Crohn's disease and ulcerative colitis. CYR61 may serve essential roles as either an oncogene or a tumor suppressor, depending on the cancer cell type. CYR61 also induces angiogenesis, which supplies oxygen and nutrients to tumors during growth. CYR61 can also play a role in the proliferation, invasion, survival, and metastasis of cancer cells. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25129 Product name: Recombinant human CYR61 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 165-239 aa of BC001271 Sequence: EDSIKDPMEDQDGLLGKELGFDASEVELTRNNELIAVGKGSSLKRLPVFGMEPRILYNPLQGQKCIVQTTSWSQC Predict reactive species Full Name: cysteine-rich, angiogenic inducer, 61 Calculated Molecular Weight: 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC001271 Gene Symbol: CYR61 Gene ID (NCBI): 3491 RRID: AB_2880604 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00622 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.