Proteintech, 26692-1-AP, TRAF3IP2 Polyclonal antibody

Size: 20ul / 150ul The TRAF3IP2 (26692-1-AP) by Proteintech is a Polyclonal antibody targeting TRAF3IP2 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 26692-1-AP targets TRAF3IP2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, A549 cells, HepG2 cells Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24840 Product name: Recombinant human TRAF3IP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC002823 Sequence: MNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPTMLHNSSGDFSQAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCSAVSEPASESVVGALPAEHQFSFMEKRNQWLVSQLSAASPDTGHDSDKSDQSLPNASADSLGGSQEMVQRPQPHRNRAGLDLPTIDTGYDSQPQDVLGIRQLERPLPLTSVCYPQDLPRPLRSREFPQFEPQRYPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPRAAYQQVIQPALPGQPLPGASVRGLHPVQKVILNYPSPWDQEERPAQRDCSFPGLPRHQDQPHHQPPN Predict reactive species Full Name: TRAF3 interacting protein 2 Calculated Molecular Weight: 65 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC002823 Gene Symbol: TRAF3IP2 Gene ID (NCBI): 10758 RRID: AB_2880606 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43734 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.