Proteintech, 26704-1-AP, FLVCR2 Polyclonal antibody

Size: 20ul / 150ul The FLVCR2 (26704-1-AP) by Proteintech is a Polyclonal antibody targeting FLVCR2 in WB, ELISA applications with reactivity to human, mouse, rat samples 26704-1-AP targets FLVCR2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24928 Product name: Recombinant human FLVCR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 476-526 aa of BC019087 Sequence: FLTLGAALTAFIKADLRRQKANKETLENKLQEEEEESNTSKVPTAVSEDHL Predict reactive species Full Name: feline leukemia virus subgroup C cellular receptor family, member 2 Calculated Molecular Weight: 526 aa, 57 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC019087 Gene Symbol: FLVCR2 Gene ID (NCBI): 55640 RRID: AB_2918106 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UPI3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.