Proteintech, 26726-1-AP, EVA1A Polyclonal antibody

Size: 20ul / 150ul The EVA1A (26726-1-AP) by Proteintech is a Polyclonal antibody targeting EVA1A in IHC, ELISA applications with reactivity to human, mouse samples 26726-1-AP targets EVA1A in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24990 Product name: Recombinant human FAM176A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 57-108 aa of BC063016 Sequence: ISCHTDCRRRPGKKFLQDRESSSDSSDSEDGSEDTVSDLSVRRHRRFERTLN Predict reactive species Full Name: family with sequence similarity 176, member A Calculated Molecular Weight: 17 kDa GenBank Accession Number: BC063016 Gene Symbol: FAM176A Gene ID (NCBI): 84141 RRID: AB_2880615 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H8M9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.