Proteintech, 26742-1-AP, RAB7B Polyclonal antibody

Size: 20ul / 150ul The RAB7B (26742-1-AP) by Proteintech is a Polyclonal antibody targeting RAB7B in WB, ELISA applications with reactivity to human samples 26742-1-AP targets RAB7B in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U-937 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25035 Product name: Recombinant human RAB7B protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 100-199 aa of BC017092 Sequence: DIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC Predict reactive species Full Name: RAB7B, member RAS oncogene family Calculated Molecular Weight: 199 aa, 23 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC017092 Gene Symbol: RAB7B Gene ID (NCBI): 338382 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96AH8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.