Iright
BRAND / VENDOR: Proteintech

Proteintech, 26746-1-AP, ENTPD5 Polyclonal antibody

CATALOG NUMBER: 26746-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ENTPD5 (26746-1-AP) by Proteintech is a Polyclonal antibody targeting ENTPD5 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 26746-1-AP targets ENTPD5 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Ectonucleoside triphosphate diphosphohydrolases (NTPDases) are enzymes that are involved in the degradation of di- and triphosphate nucleotides, with important implications in several biological processes that underlie a number of physiological and pathological conditions, including cancer [PMID: 34272651]. ENTPD5 gene, hydrolyzes UDP to UMP and is mainly localized inside the cell, where it plays a critical role in the N-glycosylation and proper folding of proteins in the endoplasmic reticulum [PMID: 21074248]. It can also be secreted into the extracellular space and can work as a soluble enzyme upon cleavage of a signal peptide [PMID: 15698960]. NTPDase5 is often deregulated in cancer, likely as a consequence of TP53 mutations, where it promotes and favours tumour progression and metastasis [PMID: 27956623]. Furthermore, short NPTDase5 peptides were detected in normal and tumour cell lines, recalling the mt-PCPH oncoprotein, a truncated form of the enzyme originating from a single-nucleotide deletion described in Syrian hamster and lacking enzymatic activity [PMID: 27956623]. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25022 Product name: Recombinant human ENTPD5 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 335-428 aa of BC130485 Sequence: RAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQLTKKVNNIETGWALGATFHLLQSLGISH Predict reactive species Full Name: ectonucleoside triphosphate diphosphohydrolase 5 Observed Molecular Weight: 47 kDa GenBank Accession Number: BC130485 Gene Symbol: ENTPD5 Gene ID (NCBI): 957 RRID: AB_2880619 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75356 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924