Proteintech, 26750-1-AP, DIRC2 Polyclonal antibody

Size: 20ul / 150ul The DIRC2 (26750-1-AP) by Proteintech is a Polyclonal antibody targeting DIRC2 in WB, ELISA applications with reactivity to human, mouse samples 26750-1-AP targets DIRC2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24687 Product name: Recombinant human DIRC2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 180-281 aa of BC039821 Sequence: ATATAIASMLSYLGGACAFLVGPLVVPAPNGTSPLLAAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYFPPRPPLPPSVAAASQRLSYRRSVCRLLSNFR Predict reactive species Full Name: disrupted in renal carcinoma 2 Calculated Molecular Weight: 478 aa, 52 kDa Observed Molecular Weight: 48-52 kDa GenBank Accession Number: BC039821 Gene Symbol: DIRC2 Gene ID (NCBI): 84925 RRID: AB_2880621 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96SL1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.