Proteintech, 26751-1-AP, SFRS11 Polyclonal antibody

Size: 20ul / 150ul The SFRS11 (26751-1-AP) by Proteintech is a Polyclonal antibody targeting SFRS11 in WB, IHC, ELISA applications with reactivity to human, rat samples 26751-1-AP targets SFRS11 in WB, IHC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HEK-293T cells Positive IHC detected in: human breast cancer tissue, rat colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25015 Product name: Recombinant human SFRS11 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 398-483 aa of BC040436 Sequence: KKKSKDKEKDRERKSESDKDVKVTRDYDEEEQGYDSEKEKKEEKKPIETGSPKTKECSVEKGTGDSLRESKVNGDDHHEEDMDMSD Predict reactive species Full Name: splicing factor, arginine/serine-rich 11 Calculated Molecular Weight: 483 aa, 53 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC040436 Gene Symbol: SFRS11 Gene ID (NCBI): 9295 RRID: AB_3085902 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q05519 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.