Product Description
Size: 20ul / 150ul
The CENPA (26754-1-AP) by Proteintech is a Polyclonal antibody targeting CENPA in WB, IHC, ELISA applications with reactivity to human samples
26754-1-AP targets CENPA in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: MCF-7 cells, Jurkat cells
Positive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
Centromere protein-A (CENP-A) is a Histone H3-like protein that contains a C-terminal H3-like domain, required for centro-mere localization of CENP-A, and an antigenic N-terminal domain. CENP-A, originally isolated from HeLa cells, is essential for kinetochore targeting of CENP-C. In the presence of DNA, CENP-A forms an octameric complex with histones H4, H2A and H2B. CENP-A specifically localizes to active centromeres and is a component of specialized centromeric nucleosomes, on which kinetochores are assembled. CENP-A is essential for nucleosomal packaging of centromeric DNA at interphase and functions as a centromere formation marker on the chromosome.
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag25025 Product name: Recombinant human CENPA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-59 aa of BC002703 Sequence: MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTH Predict reactive species
Full Name: centromere protein A
Calculated Molecular Weight: 16 kDa
Observed Molecular Weight: 16-20 kDa
GenBank Accession Number: BC002703
Gene Symbol: CENPA
Gene ID (NCBI): 1058
RRID: AB_2880622
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P49450
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924