Proteintech, 26757-1-AP, LIF Polyclonal antibody

Size: 20ul / 150ul The LIF (26757-1-AP) by Proteintech is a Polyclonal antibody targeting LIF in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse samples 26757-1-AP targets LIF in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, U-87 MG cells Positive IHC detected in: human lung cancer tissue, mouse embryo tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse embryo tissue Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information LIF is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface. LIF is a glycoprotein with variable molecular weight (38-67 kDa) due to differential glycosylation. (PMID: 8262236, PMID: 35204717) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25076 Product name: Recombinant human LIF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-202 aa of BC093733 Sequence: ITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF Predict reactive species Full Name: leukemia inhibitory factor (cholinergic differentiation factor) Calculated Molecular Weight: 202 aa, 22 kDa Observed Molecular Weight: 22 kDa, 32 kDa GenBank Accession Number: BC093733 Gene Symbol: LIF Gene ID (NCBI): 3976 RRID: AB_2880624 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P15018 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.