Product Description
Size: 20ul / 150ul
The Myogenin (26762-1-AP) by Proteintech is a Polyclonal antibody targeting Myogenin in WB, ELISA applications with reactivity to human, mouse, rat samples
26762-1-AP targets Myogenin in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse heart tissue, mouse skeletal muscle tissue, rat heart tissue, rat skeletal muscle tissue
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Background Information
MYOG (encoded Myogenin protein) is a muscle-specific transcription factor that belongs to a family of basic helix-loop-helix transcription factors. It plays a role in muscle differentiation, cell cycle exit, and muscle atrophy(PMID: 30315160). Diseases associated with MYOG include Embryonal Rhabdomyosarcoma and Gallbladder Sarcoma.
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag25081 Product name: Recombinant human Myogenin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 138-224 aa of BC053899 Sequence: SLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN Predict reactive species
Full Name: myogenin (myogenic factor 4)
Calculated Molecular Weight: 25 kDa
Observed Molecular Weight: 30 kDa
GenBank Accession Number: BC053899
Gene Symbol: Myogenin
Gene ID (NCBI): 4656
RRID: AB_3669566
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P15173
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924