Iright
BRAND / VENDOR: Proteintech

Proteintech, 26766-1-AP, ARHGAP28 Polyclonal antibody

CATALOG NUMBER: 26766-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ARHGAP28 (26766-1-AP) by Proteintech is a Polyclonal antibody targeting ARHGAP28 in WB, IHC, ELISA applications with reactivity to human, mouse samples 26766-1-AP targets ARHGAP28 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: C2C12 cells, mouse testis tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information ARHGAP28 (Rho GTPase Activating Protein 28), also known as FLJ10312 and KIAA1314, is a Rho GTPase activating protein (RhoGAP) that switches RhoA to its inactive form. It is reported that high expression of ARHGAP28 in osteosarcoma cell lines can inhibit the proliferation, migration, and invasion of osteosarcoma(PMID: 38041020). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25293 Product name: Recombinant human ARHGAP28 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-167 aa of BC065274 Sequence: MNELPRDTCGNHTNQLDGTKEERELPRVIKTSGSMPDDASLNSTTLSDASQDKEGSFAVPRSDSVAILETIPVLPVHSNGSPEPGQPVQNAISDDDFLEKNIPPEAEELSFEVSYSEMVTEALKRNKLKKSEIKKEDYVLTKFNVQKTRFGLTEAGDLSAEDMKKIR Predict reactive species Full Name: Rho GTPase activating protein 28 Observed Molecular Weight: 82-90kDa GenBank Accession Number: BC065274 Gene Symbol: ARHGAP28 Gene ID (NCBI): 79822 RRID: AB_3669567 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: B4DXL2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924