Iright
BRAND / VENDOR: Proteintech

Proteintech, 26772-1-AP, IL-24 Polyclonal antibody

CATALOG NUMBER: 26772-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The IL-24 (26772-1-AP) by Proteintech is a Polyclonal antibody targeting IL-24 in WB, IHC, ELISA applications with reactivity to human, mouse samples 26772-1-AP targets IL-24 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue Positive IHC detected in: human colon tissue, human malignant melanoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:800-1:3200 Background Information IL24, also named as MDA-7, MDA7 or ST16, belongs to the IL-10 family. It has antiproliferative properties on melanoma cells and may contribute to terminal cell differentiation. The induction of IL24 by oncogenes may support tumor growth at the early stages of cancer. The observed molecular weight of IL24 is reported between 25 and 35 kDa, a value higher than the deduced molecular weight of 23 kDa. This difference is likely due to post-translational modifications, such as glycosylation of the endogenously produced molecule. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25071 Product name: Recombinant human IL-24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 53-207 aa of BC009681 Sequence: QEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL Predict reactive species Full Name: interleukin 24 Calculated Molecular Weight: 207 aa, 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC009681 Gene Symbol: IL-24 Gene ID (NCBI): 11009 RRID: AB_2880630 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13007 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924