Proteintech, 26788-1-AP, RASGRF2 Polyclonal antibody

Size: 20ul / 150ul The RASGRF2 (26788-1-AP) by Proteintech is a Polyclonal antibody targeting RASGRF2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 26788-1-AP targets RASGRF2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat brain tissue, mouse brain tissue Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25354 Product name: Recombinant human RASGRF2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 748-876 aa of BC136296 Sequence: TSPLNSKIGALDLTTSSSPTTTTQSPAASPPPHTGQIPLDLSRGLSSPEQSPGTVEENVDNPRVDLCNKLKRSIQKAVLESAPADRAGVESSPAADTTELSPCRSPSTPRHLRYRQPGGQTADNAHCSV Predict reactive species Full Name: Ras protein-specific guanine nucleotide-releasing factor 2 Observed Molecular Weight: 141 kDa GenBank Accession Number: BC136296 Gene Symbol: RASGRF2 Gene ID (NCBI): 5924 RRID: AB_2918110 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14827 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.