Proteintech, 26796-1-AP, SLC22A7 Polyclonal antibody

Size: 20ul / 150ul The SLC22A7 (26796-1-AP) by Proteintech is a Polyclonal antibody targeting SLC22A7 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 26796-1-AP targets SLC22A7 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, rat liver tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human liver tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information Organic anion transporter (OAT)2 (SLC22A7) belongs to the solute carrier group of membrane transport proteins that mediate cellular uptake of numerous organic ions including xenobiotics and endogenous substrates (PMID: 9529348, 20190416). SLC22A7 was originally identified as a novel liver-specific transporter because of its predominant mRNA expression in the rat liver (PMID: 15900017, 25904762). Human SLC22A7 exhibits a robust transport function for a wide array of naturally occurring nucleobases, nucleosides, and nucleotides with a particular role for cGMP (PMID: 18216183). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25217 Product name: Recombinant human SLC22A7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 42-140 aa of BC033805 Sequence: AAVPAHRCALPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYDHSEFSSTIATESQWDLVCEQ Predict reactive species Full Name: solute carrier family 22 (organic anion transporter), member 7 Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC033805 Gene Symbol: SLC22A7 Gene ID (NCBI): 10864 RRID: AB_2880639 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y694 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.