Proteintech, 26798-1-AP, GPSM2 Polyclonal antibody

Size: 20ul / 150ul The GPSM2 (26798-1-AP) by Proteintech is a Polyclonal antibody targeting GPSM2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 26798-1-AP targets GPSM2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse heart tissue, HEK-293T cells, mouse liver tissue, HEK-293 cells Positive IHC detected in: human placenta tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information GPSM2 belongs to a family of proteins that modulate activation of G proteins. GPSM2 assists in the exchange of guanine nucleotides, and allows extracellular signals to be transmitted to cells via cell surface, and ultimately plays a key role in the activation of G-proteins. Therefore, GPSM2 is a critical factor for the stability of cell division. Some recent studies have shown that GPSM2 messenger RNA (mRNA) is overexpressed and plays a positive role in the development of certain tumors, such as liver cancer, pancreatic cancer, breast cancer. It also plays a role in neuroblast division and in the development of normal hearing. Mutations in GPSM2 are associated with autosomal recessive nonsyndromic deafness (DFNB82), which is a form of non-syndromic deafness characterized by prelingual, bilateral, severe, sensorineural hearing loss. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25195 Product name: Recombinant human GPSM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 559-600 aa of BC027732 Sequence: FSNLPGLRLTQNSQSVLSHLMTNDNKEADEDFFDILVKCQGS Predict reactive species Full Name: G-protein signaling modulator 2 (AGS3-like, C. elegans) Calculated Molecular Weight: 75 kDa Observed Molecular Weight: 70-77 kDa GenBank Accession Number: BC027732 Gene Symbol: GPSM2 Gene ID (NCBI): 29899 RRID: AB_2880640 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P81274 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.