Proteintech, 26799-1-AP, SLC39A1/ZIP1 Polyclonal antibody

Size: 20ul / 150ul The SLC39A1/ZIP1 (26799-1-AP) by Proteintech is a Polyclonal antibody targeting SLC39A1/ZIP1 in WB, ELISA applications with reactivity to human samples 26799-1-AP targets SLC39A1/ZIP1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PC-3 cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information SLC39A1, also known as ZIP1, is a member of the zinc-iron permease family. It is localized to the cell membrane and acts as a zinc uptake transporter. SLC39A1 mediates the influx of Zn2+ into cells from extracellular space(PMID: 16844077).SLC39A1 is the major importer of zinc from circulating blood plasma into prostate cells (PMID: 12888280). In mesenchymal stem cells (MSCs), ZIP1 may exist as a dimer with a molecular weight of 70kD(PMID:16203195). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24937 Product name: Recombinant human SLC39A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 90-179 aa of BC003152 Sequence: PDYLAAIDEALAALHVTLQFPLQEFILAMGFFLVLVMEQITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALR Predict reactive species Full Name: solute carrier family 39 (zinc transporter), member 1 Calculated Molecular Weight: 324 aa, 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC003152 Gene Symbol: SLC39A1 Gene ID (NCBI): 27173 RRID: AB_3669568 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NY26 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.