Proteintech, 26804-1-AP, SLC25A12 Polyclonal antibody

Size: 20ul / 150ul The SLC25A12 (26804-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A12 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 26804-1-AP targets SLC25A12 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, mouse kidney tissue, mouse skeletal muscle tissue, rat heart tissue Positive IHC detected in: human breast cancer tissue, human pancreas cancer tissue, human stomach cancer tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information SLC25A12, also known as ARALAR1, is a key component of the malate-aspartate shuttle, a metabolic system that facilitates the transfer of reducing equivalents (NADH) from the cytoplasm into mitochondria, thereby supporting oxidative phosphorylation and ATP production. SLC25A12 dysfunction results in impaired mitochondrial energy production, which can lead to neuronal damage, developmental delays, and myelination defects (PMID: 20015484). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25150 Product name: Recombinant human SLC25A12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-64 aa of BC016932 Sequence: MAVKVQTTKRGDPHELRNIFLQYASTEVDGERYMTPEDFVQRYLGLYNDPNSNPKIVQLLAGVA Predict reactive species Full Name: solute carrier family 25 (mitochondrial carrier, Aralar), member 12 Calculated Molecular Weight: 75 kDa, 63 kDa Observed Molecular Weight: ~70 kDa GenBank Accession Number: BC016932 Gene Symbol: SLC25A12 Gene ID (NCBI): 8604 RRID: AB_2880641 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75746 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.