Iright
BRAND / VENDOR: Proteintech

Proteintech, 26808-1-AP, MS4A2 Polyclonal antibody

CATALOG NUMBER: 26808-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MS4A2 (26808-1-AP) by Proteintech is a Polyclonal antibody targeting MS4A2 in WB, ELISA applications with reactivity to human, mouse samples 26808-1-AP targets MS4A2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information MS4A is a new gene family with four transmembrane-spanning domains and is crucial for cell differentiation, signaling, and cell cycle control. The membrane-spanning 4 domains, superfamily A, number 2 gene (MS4A2, also named as the beta-chain of the high affinity IgE receptor or FcεRIβ gene, FCER1B), as a member of the MS4A family, is a component of the high-affinity IgE receptor, with co-immunoprecipitation experiments demonstrating that it associates with FcɛRIα and FcRγ to form a tetrameric receptor complex (αβγ2) that is expressed on mast cells and basophils at high density(PMID: 25835430). MS4A2 is strongly associated with the prognosis of lung adenocarcinoma and lung cancer brain metastases(PMID: 37533433). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25196 Product name: Recombinant human MS4A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-92 aa of BC074843 Sequence: MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEFLGVTQILTAMICLCFGTVVCSVLDISHIEGDI Predict reactive species Full Name: membrane-spanning 4-domains, subfamily A, member 2 (Fc fragment of IgE, high affinity I, receptor for; beta polypeptide) Calculated Molecular Weight: 244 aa, 27 kDa Observed Molecular Weight: 25-27 kDa GenBank Accession Number: BC074843 Gene Symbol: MS4A2 Gene ID (NCBI): 2206 RRID: AB_3085906 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q01362 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924